NOS1AP

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030066

 

Antibody HPA055561

 

Antibody CAB018582

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA030066 HPA055561 sc-9138 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

13 13 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

105 82  

Antigen sequence

HTGSKVSHPQEPMLTASPRMLLPSSSSKPPGLGTETPLSTHHQMQLLQQL
LQQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHI
SLLVK
 
KKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDP
GRQLTGAERASTATAEETDIDAVEVPLPGNDV
 
 

Matching transcripts

NOS1AP-001 - ENSP00000355133 [100%]
NOS1AP-008 - ENSP00000431586 [100%]
 NOS1AP-001 - ENSP00000355133 [100%]
NOS1AP-008 - ENSP00000431586 [100%]
NOS1AP-009 - ENSP00000396713 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.
More information
 Immunohistochemical staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human hippocampus shows cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:1000 1:2500 1:350 

Literature conformity

Consistent with gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data Mainly consistent with RNAseq data Mainly not consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & vesicles.
More information
 Application not done for this antibody. Immunofluorescent staining of human cell line U-251 MG shows positivity in mitochondria & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:118  1:25 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

56.1, 55.6 56.1, 55.6, 38.8 56.1, 55.6, 38.8, 23.0, 8.6, 5.9 

Antibody dilution

1:250 1:360 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:2900  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
NOS1AP-001
 
NOS1AP-008
 
NOS1AP-009