DMD

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002725

 

Antibody HPA023885

 

Antibody CAB000119

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Lab Vision/NeoMarkers
 

Product name

HPA002725 HPA023885 MS-486 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

2 5 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

148 150  

Antigen sequence

VVCQQSATQRLEHAFNIARYQLGIEKLLDPEDVDTTYPDKKSILMYITSL
FQVLPQQVSIEAIQEVEMLPRPPKVTKEEHFQLHHQMHYSQQITVSLAQG
YERTSSPKPRFKSYAYTQAAYVTTSDPTRSPFPSQHLEAPEDKSFGSS
 
KQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQEPRELP
PEERAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKIDETLERLQELQEA
TDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENV
 
 

Matching transcripts

DMD-001 - ENSP00000354923 [100%]
DMD-002 - ENSP00000288447 [100%]
DMD-006 - ENSP00000367948 [100%]
 DMD-001 - ENSP00000354923 [99%]
DMD-006 - ENSP00000367948 [99%]
DMD-016 - ENSP00000417123 [99%]
DMD-017 - ENSP00000350765 [99%]
DMD-021 - ENSP00000420046 [99%]
DMD-201 - ENSP00000340057 [99%]
DMD-202 - ENSP00000352894 [99%]
DMD-203 - ENSP00000367979 [99%]
DMD-204 - ENSP00000444119 [99%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human heart muscle shows strong cytoplasmic and membranous positivity in myocytes.
More information
 Immunohistochemical staining of human heart muscle shows distinct membranous positivity.
More information
 Immunohistochemical staining of human heart muscle shows moderate membranous positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH9 

Antibody dilution

1:25 1:3000 1:100 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

Target too small/large to be analyzed with the present setup  Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

426.8, 426.0, 88.8 426.8, 426.0, 163.6, 159.4, 143.2, 141.8, 141.4, 130.8, 129.0 426.8, 426.0, 163.6, 159.4, 143.2, 141.8, 141.4, 130.8, 129.0, 88.8, 72.2, 70.7, 70.4, 59.8, 27.4, 16.1, 14.5, 12.0, 5.3, 3.5 

Antibody dilution

 1:250 1:500 

Validation WB

 Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:2000 1:20000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
DMD-001
 
DMD-002
 
DMD-006
 
DMD-016
 
DMD-017
 
DMD-021
 
DMD-201
 
DMD-202
 
DMD-203
 
DMD-204