C16orf96

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA042009

 

Antibody HPA042058

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA042009 HPA042058 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

86 74 

Antigen sequence

LQDLLTDLHALQVTITALRKEVDMLKNMLDKVHPERMDIFAEDFKIQNWK
MVALQREVASLQNKFKTIPKTEDMVLWSGLHDAMFT
 
SFSLTFTELANIAIPQCGVLNFKALHLLLHGILEHIHMAELKKVLSGDED
FLQTSQVVIMPREGDAQPILNPMK
 

Matching transcripts

C16orf96-001 - ENSP00000415027 [100%]
 C16orf96-001 - ENSP00000415027 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.
More information
 Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:1200 1:50 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Not at all consistent with RNAseq data Not at all consistent with RNAseq data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 

Antibody dilution

1:143 1:175 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

125.0 125.0 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:6000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
C16orf96-001