CTAGE1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000387

 

Antibody HPA000922

 

Antibody CAB016204

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA000387 HPA000922 sc-53514 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

2 2 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

116 110  

Antigen sequence

NEMKLHRKLTVEENYRLEKEEKLSKVDEKISHATEELETYRKRAKDLEEE
LERTIHSYQGQIISHEKKAHDNWLAARNAERNLNDLRKENAHNRQKLTET
ELKFELLEKDPYALDV
 
EKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQDELMA
DISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQ
LQESQKQLLQ
 
 

Matching transcripts

CTAGE1-001 - ENSP00000375220 [82%]
 CTAGE1-001 - ENSP00000375220 [89%]
  

Other gene match

CTAGE5 - ENSG00000150527 [100%]
CTAGE4 - ENSG00000225932 [84%]
CTAGE9 - ENSG00000236761 [84%]
CTAGE8 - ENSG00000244693 [84%]
RP11-407N17.3 - ENSG00000258941 [100%]
CTAGE15 - ENSG00000271079 [83%]
CTAGE6 - ENSG00000271321 [83%]
 CTAGE5 - ENSG00000150527 [100%]
CTAGE4 - ENSG00000225932 [82%]
CTAGE9 - ENSG00000236761 [81%]
CTAGE8 - ENSG00000244693 [82%]
RP11-407N17.3 - ENSG00000258941 [100%]
CTAGE15 - ENSG00000271079 [82%]
CTAGE6 - ENSG00000271321 [82%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human bone marrow shows distinct cytoplasmic and membranous positivity in a subset of bone marrow poietic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:2000 1:250 1:100 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein chara Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein chara Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

151.7, 91.6, 91.0, 89.6, 88.1, 88.0, 87.9, 87.8, 86.8, 86.5, 85.3, 82.4, 81.8 151.7, 91.6, 91.0, 89.6, 88.1, 88.0, 87.9, 87.8, 86.8, 86.5, 85.3, 82.4, 81.8 85.3, 8.4 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:2000 1:1000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CTAGE1-001