NEURL1B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA037612

 

Antibody HPA057518

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA037612 HPA057518 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

64 98 

Antigen sequence

ALIDVYGITDEVQLLESAFADTLTPARLSQARFSACLPPSSHDAANFDNN
ELENNQVVAKLGHL
 
RLLCVDTTQALWAFFAVRGGVAGQLRLLGTLQSSPATTTPSGSLSGSQDD
SDSDMTFSVNQSSSASESSLVTAPSSPLSPPVSPVFSPPEPAGIKNGE
 

Matching transcripts

NEURL1B-001 - ENSP00000358815 [100%]
NEURL1B-003 - ENSP00000430001 [81%]
 NEURL1B-001 - ENSP00000358815 [100%]
NEURL1B-003 - ENSP00000430001 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:225  

Literature conformity

No avaliable characterization data  

RNA consistency

Not done  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & vesicles.
More information
 

Antibody dilution

1:103 1:122 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

59.3, 39.1 59.3, 39.1 

Antibody dilution

1:250 1:400 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:4900 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
NEURL1B-001
 
NEURL1B-003