PGA3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046875

 

Antibody CAB026358

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA046875 3460.00.02 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

10 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Genetic immunization 

Length (aa)

59  

Antigen sequence

GTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQ
YPVPPSAYI
 
 

Matching transcripts

PGA3-001 - ENSP00000322192 [100%]
PGA3-007 - ENSP00000439846 [100%]
PGA3-008 - ENSP00000440177 [100%]
PGA3-010 - ENSP00000443732 [100%]
  

Other gene match

PGA4 - ENSG00000229183 [100%]
PGA5 - ENSG00000256713 [100%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in chief cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:1000 1:1500 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

42.0, 27.9, 24.6, 24.5, 13.3 42.0, 27.9, 24.6, 19.7, 13.3 

Antibody dilution

1:230 1:500 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:1800  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
PGA3-001
 
PGA3-007
 
PGA3-008
 
PGA3-010