TMEM253

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA052329

 

Antibody HPA065092

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA052329 HPA065092 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

61 22 

Antigen sequence

LLSQRKPGCCRSQSLHYQELQEGFSELEEVPGLENGPTVASTGANERVGQ
REQTRAALLPP
 
GTVTLELRRAPRLWKVRAMMIF
 

Matching transcripts

TMEM253-003 - ENSP00000451229 [100%]
TMEM253-201 - ENSP00000453962 [100%]
 TMEM253-001 - ENSP00000453121 [100%]
TMEM253-003 - ENSP00000451229 [100%]
TMEM253-201 - ENSP00000453962 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human skin shows strong cytoplasmic positivity in basal layers of epidermal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:200 1:900 

Literature conformity

No avaliable gene/protein characterization data No avaliable gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data Mainly not consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line CACO-2 shows positivity in nucleus.
More information
 Application not done for this antibody. 

Antibody dilution

1:53  

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

23.5 23.5, 14.1 

Antibody dilution

1:260 1:220 

Validation WB

Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2100 1:2650 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
TMEM253-001
 
TMEM253-003
 
TMEM253-201