LYRM9

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA023051

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA023051 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

57 

Antigen sequence

QLYRYLLRCCQQLPTKGIQQHYKHAVRQSFRVHSDEDNPERIQQIIKRAI
EDADWIM
 

Matching transcripts

LYRM9-001 - ENSP00000368397 [100%]
LYRM9-002 - ENSP00000464378 [100%]
LYRM9-003 - ENSP00000368396 [100%]
LYRM9-005 - ENSP00000426554 [100%]
LYRM9-006 - ENSP00000421807 [100%]
 

Other gene match

RP1-66C13.4 - ENSG00000266202 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:40 

Literature conformity

No avaliable characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

 

Target mass (kDa)

17.7, 10.8, 10.0, 9.4 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
LYRM9-001
 
LYRM9-002
 
LYRM9-003
 
LYRM9-005
 
LYRM9-006