PSMB9

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA042818

 

Antibody HPA053280

 

Antibody CAB015180

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA042818 HPA053280 sc-28809 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

13 12 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

43 38  

Antigen sequence

GIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGG
 
GVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGS
 
 

Matching transcripts

PSMB9-001 - ENSP00000363993 [100%]
PSMB9-005 - ENSP00000378739 [100%]
PSMB9-006 - ENSP00000394363 [100%]
PSMB9-202 - ENSP00000394773 [100%]
 PSMB9-001 - ENSP00000363993 [100%]
PSMB9-005 - ENSP00000378739 [100%]
PSMB9-006 - ENSP00000394363 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Application not done for this antibody. Immunohistochemical staining of human tonsil shows weak nuclear positivity in germinal center cells.
More information
 Immunohistochemical staining of human lymph node shows moderate cytoplasmic and nuclear positivity in non-germinal and germinal center cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:200 1:575 

Literature conformity

 Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

 Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nuclear membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
 

Antibody dilution

1:200 1:9 1:125 

Validation IF

Supportive: The subcellular location is supported by literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

23.3, 21.0, 16.4, 13.9 23.3, 21.0, 13.9 23.3, 21.0, 16.4, 13.9 

Antibody dilution

1:250 1:90 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:750  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PSMB9-001
 
PSMB9-005
 
PSMB9-006
 
PSMB9-202