KCTD7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001407

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA001407 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

149 

Antigen sequence

DRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRDLSIEEQSECAQDF
YHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKD
LAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVP
 

Matching transcripts

KCTD7-201 - ENSP00000370208 [100%]
KCTD7-202 - ENSP00000398177 [100%]
KCTD7-203 - ENSP00000421124 [100%]
 

Other gene match

RABGEF1 - ENSG00000154710 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human skin shows nuclear positivity in epidermal and adnexal cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:250 

Literature conformity

Not consistent with gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleoli & cytoplasm.
More information
 

Antibody dilution

1:118 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

61.2, 58.5, 58.4, 56.9 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
KCTD7-201
 
KCTD7-202
 
KCTD7-203