C4A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046356

 

Antibody HPA048287

 

Antibody HPA050103

 

Antibody CAB009811

 

Antibody CAB032603

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Santa Cruz Biotechnology
 

Product name

HPA046356 HPA048287 HPA050103 sc-25816 sc-25815 

Host species

Rabbit Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

12 12 12 3 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein Recombinant protein 

Length (aa)

93 86 88   

Antigen sequence

SCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCE
QRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEI
 
PGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFF
RGLESQTKLVNGQSHISLSKAEFQDALEKLNMGITD
 
LHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQ
YLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYG
 
 
 

Matching transcripts

C4A-001 - ENSP00000396688 [100%]
C4A-013 - ENSP00000420212 [100%]
 C4A-001 - ENSP00000396688 [100%]
C4A-013 - ENSP00000420212 [100%]
C4A-204 - ENSP00000446217 [100%]
 C4A-001 - ENSP00000396688 [100%]
C4A-013 - ENSP00000420212 [100%]
   

Other gene match

C4B - ENSG00000224389 [100%]
 C4B - ENSG00000224389 [100%]
 C4B - ENSG00000224389 [100%]
   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

     

Description

Immunohistochemical staining of human urinary bladder shows positivity in plasma.
More information
 Immunohistochemical staining of human rectum shows positivity in plasma.
More information
 Immunohistochemical staining of human duodenum shows positivity in plasma.
More information
 Immunohistochemical staining of human colon shows distinct positivity in plasma.
More information
 Immunohistochemical staining of human colon shows distinct positivity in plasma.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:40 1:40 1:25 1:100 1:175 

Validation IH

Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

     

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

192.8, 192.7, 187.7 192.8, 192.7, 187.7, 30.4 192.8, 192.7, 187.7 192.8, 187.7, 30.4 192.8, 187.7, 30.4 

Antibody dilution

1:250 1:230 1:130 1:500 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

     

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000 1:1850 1:1050   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
C4A-001
 
C4A-013
 
C4A-204