PRKDC

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035174

 

Antibody CAB005167

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA035174 sc-9051 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

82  

Antigen sequence

ETLSLMTKEISSVPCWQFISWISHMVALLDKDQAVAVQHSVEEITDNYPQ
AIVYPFIISSESYSFKDTSTGHKNKEFVARIK
 
 

Matching transcripts

PRKDC-201 - ENSP00000313420 [100%]
PRKDC-202 - ENSP00000345182 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong nuclear positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:650 1:200 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:200 1:50 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Target too small/large to be analyzed with the present setup Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

469.0, 465.4 469.0, 465.4, 10.1, 8.0 

Antibody dilution

 1:500 

Validation WB

Target too small/large to be analyzed with the present setup Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         siRNA

Image

  

Description

Signal downregulation > 25% by both siRNA:s.
More information
 Application not done for this antibody. 

Antibody dilution

1:200  

Validation siRNA

Supportive: The siRNA validation is supportive.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:6000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
PRKDC-201
 
PRKDC-202