CTSO

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002041

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA002041 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

106 

Antigen sequence

QFSYLFPEEFKAIYLRSKPSKFPRYSAEVHMSIPNVSLPLRFDWRDKQVV
TQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGC
NGGSTL
 

Matching transcripts

CTSO-001 - ENSP00000414904 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:20 

Literature conformity

No avaliable characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY420008)
More information
 

Target mass (kDa)

36.0 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CTSO-001