FKBP4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA006148

 

Antibody HPA062857

 

Antibody CAB017441

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Enzo Life Sciences
 

Product name

HPA006148 HPA062857 ADI-SRA-1400 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 13 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Native protein 

Length (aa)

122 89  

Antigen sequence

IATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLT
EEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIG
EGENLDLPYGLERAIQRMEKGE
 
DFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFER
LAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVE
 
 

Matching transcripts

FKBP4-001 - ENSP00000001008 [100%]
 FKBP4-001 - ENSP00000001008 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.
More information
 Application not done for this antibody. Immunohistochemical staining of human testis shows nuclear positivity in cells of the seminiferus ducts.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:1250  1:1700 

Literature conformity

Consistent with extensive gene/protein characterization data  Consistent with extensive gene/protein characterization data 

RNA consistency

Not done  Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line MCF7 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 

Antibody dilution

1:125 1:147 1:200 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

51.8 51.8 51.8, 9.5, 5.5, 2.5 

Antibody dilution

1:250 1:490 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:2000 1:6000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
FKBP4-001