FKBP4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA006148

 

Antibody CAB017441

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Enzo Life Sciences
 

Product name

HPA006148 ADI-SRA-1400 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Native protein 

Length (aa)

122  

Antigen sequence

IATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLT
EEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIG
EGENLDLPYGLERAIQRMEKGE
 
 

Matching transcripts

FKBP4-001 - ENSP00000001008 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.
More information
 Immunohistochemical staining of human testis shows nuclear positivity in cells of the seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:1250 1:1700 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 

Antibody dilution

1:125 1:200 

Validation IF

Supportive: The subcellular location is supported by literature. Non-supportive: The subcellular location is not consistent with literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

51.8 51.8, 9.5, 5.5, 2.5 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:2000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
FKBP4-001