ITGA2B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031168

 

Antibody HPA031169

 

Antibody HPA031170

 

Antibody HPA031171

 

Antibody CAB018611

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA031168 HPA031169 HPA031170 HPA031171 sc-15328 

Host species

Rabbit Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

7 7 7 7 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

77 99 93 61  

Antigen sequence

CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGA
HYMRALSNVEGFERLICNQKKENETRV
 
NDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSY
RPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVG
 
GATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKH
SPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAV
 
FGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSL
LFDLRDETRNV
 
 

Matching transcripts

ITGA2B-001 - ENSP00000262407 [100%]
ITGA2B-201 - ENSP00000340536 [100%]
 ITGA2B-001 - ENSP00000262407 [100%]
ITGA2B-201 - ENSP00000340536 [100%]
 ITGA2B-001 - ENSP00000262407 [100%]
ITGA2B-201 - ENSP00000340536 [100%]
 ITGA2B-001 - ENSP00000262407 [100%]
ITGA2B-201 - ENSP00000340536 [100%]
  

Other gene match

     

ANTIBODY VALIDATION

         Immunohistochemistry

Image

     

Description

Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.
More information
 Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in megakaryocytes.
More information
 Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.
More information
 Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.
More information
 Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in megakaryocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:500 1:500 1:350 1:350 1:175 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

     

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
  Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm, cell junctions & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 

Antibody dilution

1:56 1:65  1:67 1:182 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available.  Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

     

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
     

Target mass (kDa)

113.4, 109.6 113.4, 109.6 113.4, 109.6 113.4, 109.6 113.4, 109.6, 23.1, 11.4, 3.5 

Antibody dilution

1:250 1:250 1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

     

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000 1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
ITGA2B-001
 
ITGA2B-201