CACNA1G

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004714

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA004714 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

121 

Antigen sequence

KEKALVEVAASSGPPTLTSLNIPPGPYSSMHKLLETQSTGACQSSCKISS
PCLKADSGACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQH
SDLRDPHSRRQRSLGPDAEPS
 

Matching transcripts

CACNA1G-001 - ENSP00000339302 [100%]
CACNA1G-002 - ENSP00000425451 [100%]
CACNA1G-003 - ENSP00000422407 [100%]
CACNA1G-004 - ENSP00000426814 [100%]
CACNA1G-005 - ENSP00000427238 [100%]
CACNA1G-007 - ENSP00000414388 [100%]
CACNA1G-008 - ENSP00000353990 [100%]
CACNA1G-009 - ENSP00000423112 [100%]
CACNA1G-010 - ENSP00000427247 [100%]
CACNA1G-011 - ENSP00000420918 [100%]
CACNA1G-012 - ENSP00000426313 [100%]
CACNA1G-013 - ENSP00000352011 [100%]
CACNA1G-014 - ENSP00000425153 [100%]
CACNA1G-015 - ENSP00000426172 [100%]
CACNA1G-016 - ENSP00000423045 [100%]
CACNA1G-017 - ENSP00000427231 [100%]
CACNA1G-018 - ENSP00000427173 [100%]
CACNA1G-019 - ENSP00000409759 [100%]
CACNA1G-020 - ENSP00000426098 [100%]
CACNA1G-021 - ENSP00000425698 [100%]
CACNA1G-023 - ENSP00000392390 [100%]
CACNA1G-024 - ENSP00000426261 [100%]
CACNA1G-025 - ENSP00000426232 [100%]
CACNA1G-026 - ENSP00000423317 [100%]
CACNA1G-027 - ENSP00000350979 [100%]
CACNA1G-028 - ENSP00000421518 [100%]
CACNA1G-030 - ENSP00000424664 [100%]
CACNA1G-031 - ENSP00000425522 [100%]
CACNA1G-032 - ENSP00000422268 [100%]
CACNA1G-033 - ENSP00000426558 [100%]
CACNA1G-034 - ENSP00000423155 [100%]
CACNA1G-201 - ENSP00000347078 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:130 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A549 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:36 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

262.5, 261.6, 259.1, 257.7, 256.8, 256.0, 255.0, 254.4, 253.5, 252.8, 252.7, 251.9, 251.8, 251.0, 250.2, 249.3, 248.7, 248.5, 247.8, 247.0, 246.2, 244.2, 243.4, 240.9, 198.2, 197.3, 196.5, 195.8, 195.0, 194.1, 171.4 

Antibody dilution

1:250 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 « 
 
CACNA1G-001
 
CACNA1G-002
 
CACNA1G-003
 
CACNA1G-004
 
CACNA1G-005
 
CACNA1G-007
 
CACNA1G-008
 
CACNA1G-009
 
CACNA1G-010
 
CACNA1G-011
 
CACNA1G-012
 
CACNA1G-013
 
CACNA1G-014
 
CACNA1G-015
 
CACNA1G-016
 
CACNA1G-017
 
CACNA1G-018
 
CACNA1G-019
 
CACNA1G-020
 
CACNA1G-021
 
CACNA1G-023
 
CACNA1G-024
 
CACNA1G-025
 
CACNA1G-026
 
CACNA1G-027
 
CACNA1G-028
 
CACNA1G-030
 
CACNA1G-031
 
CACNA1G-032
 
CACNA1G-033
 
CACNA1G-034
 
CACNA1G-201
 
 »