CDKL3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007446

 

Antibody HPA027751

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007446 HPA027751 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

110 139 

Antigen sequence

AKVNSLIKPKESSKENELRKDERKTVYTNTLLSSSVLGKEIEKEKKPKEI
KVRVIKVKGGRGDISEPKKKEYEGGLGQQDANENVHPMSPDTKLVTIEPP
NPINPSTNCN
 
GGSVTMPPINLTNSNLMAANLSSNLFHPSVRLTERAKKRRTSSQSIGQVM
PNSRQEDPGPIQSQMEKGIFNERTGHSDQMANENKRKLNFSRSDRKEFHF
PELPVTIQSKDTKGMEVKQIKMLKRESKKTESSKIPTLL
 

Matching transcripts

CDKL3-001 - ENSP00000265334 [100%]
CDKL3-002 - ENSP00000428500 [100%]
CDKL3-006 - ENSP00000428689 [100%]
CDKL3-008 - ENSP00000430496 [100%]
CDKL3-201 - ENSP00000395559 [100%]
CDKL3-202 - ENSP00000399807 [100%]
CDKL3-203 - ENSP00000441545 [100%]
CDKL3-204 - ENSP00000477366 [100%]
CDKL3-205 - ENSP00000477164 [100%]
 CDKL3-001 - ENSP00000265334 [100%]
CDKL3-002 - ENSP00000428500 [100%]
CDKL3-006 - ENSP00000428689 [100%]
CDKL3-202 - ENSP00000399807 [100%]
CDKL3-203 - ENSP00000441545 [100%]
CDKL3-205 - ENSP00000477164 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction center.
More information
 Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:300 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Not at all consistent with RNAseq data Not at all consistent with RNAseq data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm, the Golgi apparatus & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:95 1:100 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

67.5, 67.2, 53.1, 51.6, 45.1, 41.1, 33.0, 20.7 67.5, 67.2, 53.1, 45.1, 41.1, 33.0 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
CDKL3-001
 
CDKL3-002
 
CDKL3-006
 
CDKL3-008
 
CDKL3-201
 
CDKL3-202
 
CDKL3-203
 
CDKL3-204
 
CDKL3-205