PIGQ

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039105

 

Antibody HPA039828

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039105 HPA039828 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

61 91 

Antigen sequence

EDQVMLIFYDQRQVLLSQLHLPTVLPDRQAGATTASTGGLAAVFDTVARS
EVLFRSDRFDE
 
YHTLGLEVIGSEQMWGWPARLAALHHWHCLPWDPLPTCCGHHGGEHSNPR
CPEHCPMPTLHTQVQRVRPPQQPQVEGWSPWGLPSGSALAV
 

Matching transcripts

PIGQ-001 - ENSP00000326674 [100%]
PIGQ-002 - ENSP00000026218 [100%]
PIGQ-003 - ENSP00000410434 [100%]
PIGQ-004 - ENSP00000386760 [100%]
PIGQ-005 - ENSP00000386554 [100%]
PIGQ-006 - ENSP00000413753 [100%]
PIGQ-009 - ENSP00000439650 [100%]
 PIGQ-002 - ENSP00000026218 [99%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cell.
More information
 Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:450 1:250 

Literature conformity

Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:122 1:65 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

84.1, 65.3, 63.7, 34.4, 32.5, 27.5 84.1 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:12000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
PIGQ-001
 
PIGQ-002
 
PIGQ-003
 
PIGQ-004
 
PIGQ-005
 
PIGQ-006
 
PIGQ-009