PIGQ

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039105

 

Antibody HPA039828

 

Antibody HPA061414

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039105 HPA039828 HPA061414 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 8 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

61 91 43 

Antigen sequence

EDQVMLIFYDQRQVLLSQLHLPTVLPDRQAGATTASTGGLAAVFDTVARS
EVLFRSDRFDE
 
YHTLGLEVIGSEQMWGWPARLAALHHWHCLPWDPLPTCCGHHGGEHSNPR
CPEHCPMPTLHTQVQRVRPPQQPQVEGWSPWGLPSGSALAV
 
YVYGARLYCLKIHGLSSLWRLFRGKKWNVLRQRVDSCSYDLDQ
 

Matching transcripts

PIGQ-001 - ENSP00000326674 [100%]
PIGQ-002 - ENSP00000026218 [100%]
PIGQ-004 - ENSP00000386760 [100%]
PIGQ-005 - ENSP00000386554 [100%]
PIGQ-006 - ENSP00000413753 [100%]
PIGQ-009 - ENSP00000439650 [100%]
 PIGQ-002 - ENSP00000026218 [99%]
 PIGQ-001 - ENSP00000326674 [100%]
PIGQ-002 - ENSP00000026218 [100%]
PIGQ-004 - ENSP00000386760 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cell.
More information
 Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6 HIER pH6  

Antibody dilution

1:450 1:250  

Literature conformity

Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data  

RNA consistency

Not done Not done  

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line MCF7 shows positivity in the Golgi apparatus.
More information
 

Antibody dilution

1:122 1:65 1:38 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

84.1, 65.3, 34.4, 32.5, 27.5 84.1 84.1, 65.3 

Antibody dilution

1:250 1:250 1:130 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:12000 1:1550 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
PIGQ-001
 
PIGQ-002
 
PIGQ-004
 
PIGQ-005
 
PIGQ-006
 
PIGQ-009