FYN

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA023887

 

Antibody CAB005034

 

Antibody CAB018387

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Epitomics
 Santa Cruz Biotechnology
 

Product name

HPA023887 1562-1 sc-434 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant Protein A/G 

Released in version

5 3 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Not known 

Length (aa)

150   

Antigen sequence

SFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVAL
YDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAP
VDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIR
 
 
 

Matching transcripts

FYN-001 - ENSP00000346671 [100%]
FYN-002 - ENSP00000357671 [100%]
FYN-011 - ENSP00000427993 [100%]
FYN-014 - ENSP00000357656 [100%]
FYN-017 - ENSP00000357667 [100%]
FYN-029 - ENSP00000229471 [100%]
FYN-202 - ENSP00000348295 [100%]
FYN-203 - ENSP00000440646 [100%]
FYN-020 - ENSP00000429294 [97%]
FYN-028 - ENSP00000429866 [90%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in a subset of reaction center cells and lymphoid cells outside reaction centra.
More information
 Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human lymph node shows cytoplasmic positivity in lymphoid cells outside reaction centra.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:75 1:35 1:50 

Literature conformity

Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:9 1:13 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

60.8, 60.1, 54.5, 26.0, 20.5, 19.3 60.8, 60.1, 54.7, 54.5, 26.0, 20.5, 19.3, 16.8, 16.7, 15.8, 15.3, 12.8, 12.6, 11.4, 11.1, 7.5, 7.0 60.8, 60.1, 54.7, 54.5, 26.0, 20.5, 19.3, 16.8, 16.7, 15.8, 15.3, 12.8, 12.6, 11.4, 11.1, 7.5, 7.0 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
FYN-001
 
FYN-002
 
FYN-011
 
FYN-014
 
FYN-017
 
FYN-020
 
FYN-028
 
FYN-029
 
FYN-202
 
FYN-203