ATP2C1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035116

 

Antibody HPA053533

 

Antibody CAB010207

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA035116 HPA053533 sc-5548 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

7 13 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

66 54  

Antigen sequence

AIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKI
IKSLQKNGSVVAMTGD
 
KKVERSREKIQKHVSSTSSSFLEVWLWERSGQQLVEIHPHLETGLPLTED
VSCV
 
 

Matching transcripts

ATP2C1-001 - ENSP00000424783 [100%]
ATP2C1-002 - ENSP00000329664 [100%]
ATP2C1-003 - ENSP00000422872 [100%]
ATP2C1-004 - ENSP00000423330 [100%]
ATP2C1-005 - ENSP00000352665 [100%]
ATP2C1-006 - ENSP00000425228 [100%]
ATP2C1-007 - ENSP00000425320 [100%]
ATP2C1-008 - ENSP00000427461 [100%]
ATP2C1-009 - ENSP00000423774 [100%]
ATP2C1-010 - ENSP00000421326 [100%]
ATP2C1-011 - ENSP00000395809 [100%]
ATP2C1-020 - ENSP00000402677 [100%]
ATP2C1-201 - ENSP00000376914 [100%]
ATP2C1-202 - ENSP00000432956 [100%]
ATP2C1-017 - ENSP00000424930 [97%]
 ATP2C1-005 - ENSP00000352665 [100%]
ATP2C1-006 - ENSP00000425228 [100%]
ATP2C1-007 - ENSP00000425320 [100%]
ATP2C1-202 - ENSP00000432956 [100%]
ATP2C1-003 - ENSP00000422872 [81%]
ATP2C1-010 - ENSP00000421326 [81%]
ATP2C1-020 - ENSP00000402677 [81%]
ATP2C1-201 - ENSP00000376914 [81%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 Application not done for this antibody. Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:2500  1:25 

Literature conformity

Partly consistent with extensive gene/protein characterization data  Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done  Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm, the Golgi apparatus & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:200 1:34 1:6 

Validation IF

Non-supportive: The subcellular location is not consistent with literature. Non-supportive: The subcellular location is not consistent with literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

   

Target mass (kDa)

107.1, 104.0, 103.5, 103.0, 101.2, 100.6, 98.9, 98.7, 97.5, 97.0, 34.8 107.1, 104.0, 103.5, 103.0, 101.2, 98.9, 97.5 107.1, 104.0, 103.5, 103.0, 101.2, 100.6, 98.9, 98.7, 97.5, 97.0, 34.8, 23.9, 14.0, 13.5, 11.6, 9.3, 5.8 

Antibody dilution

1:250 1:80 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:60000 1:1350  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
ATP2C1-001
 
ATP2C1-002
 
ATP2C1-003
 
ATP2C1-004
 
ATP2C1-005
 
ATP2C1-006
 
ATP2C1-007
 
ATP2C1-008
 
ATP2C1-009
 
ATP2C1-010
 
ATP2C1-011
 
ATP2C1-017
 
ATP2C1-020
 
ATP2C1-201
 
ATP2C1-202
 
 »