BTN3A1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA012565

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA012565 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

70 

Antigen sequence

KREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKK
ALFKPADVILDPKTANPILL
 

Matching transcripts

BTN3A1-001 - ENSP00000289361 [100%]
BTN3A1-006 - ENSP00000406667 [100%]
BTN3A1-002 - ENSP00000420010 [80%]
BTN3A1-007 - ENSP00000396684 [80%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in a granular pattern in renal tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:20 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in vesicles.
More information
 

Antibody dilution

1:34 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

57.7, 52.0, 41.8, 39.4 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
BTN3A1-001
 
BTN3A1-002
 
BTN3A1-006
 
BTN3A1-007