VRK2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA047503

 

Antibody CAB046459

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA047503 V2265 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

77  

Antigen sequence

KGQSINVHTPNSQKVDSQKAATKQVNKAHNRLIEKKVHSERSAESCATWK
VQKEEKLIGLMNNEAAQESTRRRQKYQ
 
 

Matching transcripts

VRK2-001 - ENSP00000342381 [100%]
VRK2-005 - ENSP00000408002 [100%]
VRK2-008 - ENSP00000398323 [100%]
VRK2-004 - ENSP00000402375 [87%]
VRK2-201 - ENSP00000404156 [87%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in granular pattern in exocrine glandular cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:800 1:3000 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

  

Target mass (kDa)

58.1, 55.4, 45.0 58.1, 55.4, 45.0, 9.5, 6.6 

Antibody dilution

1:1090 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in endoplasmic reticulum.
More information
 Application not done for this antibody. 

Antibody dilution

1:200  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:8700  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
VRK2-001
 
VRK2-004
 
VRK2-005
 
VRK2-008
 
VRK2-201