OFD1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031102

 

Antibody HPA031103

 

Antibody HPA031104

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA031102 HPA031103 HPA031104 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 6 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

82 92 89 

Antigen sequence

TALENEVYCNPKQSVIDRSVNGLINGNVVPCNGEISGDFLNNPFKQENVL
ARMVASRITNYPTAWVEGSSPDSDLEFVANTK
 
LLKEEKLELLAQNKLLKQQLEESRNENLRLLNRLAQPAPELAVFQKELRK
AEKAIVVEHEEFESCRQALHKQLQDEIEHSAQLKAQILGYKA
 
SFEETYDRKLKNELLKYQLELKDDYIIRTNRLIEDERKNKEKAVHLQEEL
IAINSKKEELNQSVNRVKELELELESVKAQSLAITKQNH
 

Matching transcripts

OFD1-001 - ENSP00000344314 [100%]
OFD1-002 - ENSP00000369941 [100%]
OFD1-201 - ENSP00000369923 [100%]
 OFD1-001 - ENSP00000344314 [100%]
OFD1-002 - ENSP00000369941 [100%]
OFD1-201 - ENSP00000369923 [100%]
 OFD1-001 - ENSP00000344314 [100%]
OFD1-002 - ENSP00000369941 [100%]
OFD1-201 - ENSP00000369923 [82%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human prostate shows distinct cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:475 1:90 1:550 

Literature conformity

Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Western Blot

Image

   

Description

   

Target mass (kDa)

116.7, 111.7, 101.0 116.7, 111.7, 101.0 116.7, 111.7, 101.0 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in microtubules.
More information
 Application not done for this antibody. 

Antibody dilution

 1:50  

Validation IF

 Supportive: The subcellular location is supported by literature.  
 

ANTIGEN VIEW

? »
 
 
 
OFD1-001
 
OFD1-002
 
OFD1-201