ADAMTS6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027216

 

Antibody HPA043441

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA027216 HPA043441 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

86 100 

Antigen sequence

GIRYKFNVPITRTGSGDNEVGFTWNHQPWSECSATCAGGKMPTRQPTQRA
RWRTKHILSYALCLLKKLIGNISCRFASSCNLAKET
 
LHGVIATEDEEYFIEPLKNTTEDSKHFSYENGHPHVIYKKSALQQRHLYD
HSHCGVSDFTRSGKPWWLNDTSTVSYSLPINNTHIHHRQKRSVSIERFVE
 

Matching transcripts

ADAMTS6-009 - ENSP00000423551 [100%]
 ADAMTS6-007 - ENSP00000370443 [100%]
ADAMTS6-008 - ENSP00000424377 [100%]
ADAMTS6-009 - ENSP00000423551 [100%]
ADAMTS6-201 - ENSP00000440995 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.
More information
 Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:60 1:500 

Literature conformity

Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data 

RNA consistency

Not applicable Not applicable 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:100  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

102.0 125.3, 102.0, 53.2, 34.2 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:6000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ADAMTS6-007
 
ADAMTS6-008
 
ADAMTS6-009
 
ADAMTS6-201