HHAT

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA016462

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA016462 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

39 

Antigen sequence

VSREHEEELDQEFELETDTLFGGLKKDATDFEWSFWMEW
 

Matching transcripts

HHAT-001 - ENSP00000261458 [100%]
HHAT-004 - ENSP00000355977 [100%]
HHAT-202 - ENSP00000375773 [100%]
HHAT-203 - ENSP00000416845 [100%]
HHAT-204 - ENSP00000442625 [100%]
HHAT-205 - ENSP00000444995 [100%]
HHAT-206 - ENSP00000438468 [92%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:30 

Literature conformity

Partly consistent with gene/protein characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

60.3, 57.3, 57.0, 49.9, 41.1 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
HHAT-001
 
HHAT-004
 
HHAT-202
 
HHAT-203
 
HHAT-204
 
HHAT-205
 
HHAT-206