CAMK2B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA026307

 

Antibody HPA051783

 

Antibody HPA051785

 

Antibody HPA053973

 

Antibody CAB006849

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Chemicon
 

Product name

HPA026307 HPA051783 HPA051785 HPA053973 MAB8699 

Host species

Rabbit Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

5 12 12 12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

75 26 27 33  

Antigen sequence

TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK
NSAAATSPKGTLPPAALEPQTTVIH
 
ELFEDIVAREYYSEADASHCIQQILE
 
LYQQIKAGAYDFPSPEWDTVTPEAKDL
 
GQEYAAKIINTKKLSARDHQKLEREARICRLLK
 
 

Matching transcripts

CAMK2B-001 - ENSP00000397937 [100%]
CAMK2B-002 - ENSP00000379098 [100%]
CAMK2B-008 - ENSP00000326375 [100%]
CAMK2B-021 - ENSP00000388951 [100%]
CAMK2B-202 - ENSP00000422416 [100%]
 CAMK2B-001 - ENSP00000397937 [100%]
CAMK2B-002 - ENSP00000379098 [100%]
CAMK2B-003 - ENSP00000379096 [100%]
CAMK2B-004 - ENSP00000351542 [100%]
CAMK2B-005 - ENSP00000326544 [100%]
CAMK2B-006 - ENSP00000326427 [100%]
CAMK2B-007 - ENSP00000326518 [100%]
CAMK2B-008 - ENSP00000326375 [100%]
CAMK2B-009 - ENSP00000326600 [100%]
CAMK2B-016 - ENSP00000390419 [100%]
CAMK2B-020 - ENSP00000388445 [100%]
CAMK2B-026 - ENSP00000258682 [100%]
CAMK2B-201 - ENSP00000390292 [100%]
 CAMK2B-001 - ENSP00000397937 [96%]
CAMK2B-002 - ENSP00000379098 [96%]
CAMK2B-003 - ENSP00000379096 [96%]
CAMK2B-004 - ENSP00000351542 [96%]
CAMK2B-005 - ENSP00000326544 [96%]
CAMK2B-006 - ENSP00000326427 [96%]
CAMK2B-007 - ENSP00000326518 [96%]
CAMK2B-008 - ENSP00000326375 [96%]
CAMK2B-009 - ENSP00000326600 [96%]
CAMK2B-026 - ENSP00000258682 [96%]
CAMK2B-201 - ENSP00000390292 [96%]
CAMK2B-202 - ENSP00000422416 [96%]
 CAMK2B-001 - ENSP00000397937 [97%]
CAMK2B-002 - ENSP00000379098 [97%]
CAMK2B-003 - ENSP00000379096 [97%]
CAMK2B-004 - ENSP00000351542 [97%]
CAMK2B-005 - ENSP00000326544 [97%]
CAMK2B-006 - ENSP00000326427 [97%]
CAMK2B-007 - ENSP00000326518 [97%]
CAMK2B-008 - ENSP00000326375 [97%]
CAMK2B-009 - ENSP00000326600 [97%]
CAMK2B-015 - ENSP00000400387 [97%]
CAMK2B-016 - ENSP00000390419 [97%]
CAMK2B-020 - ENSP00000388445 [97%]
CAMK2B-026 - ENSP00000258682 [97%]
CAMK2B-027 - ENSP00000428912 [97%]
CAMK2B-201 - ENSP00000390292 [97%]
  

Other gene match

 CAMK2A - ENSG00000070808 [100%]
CAMK2D - ENSG00000145349 [100%]
CAMK2G - ENSG00000148660 [96%]
 CAMK2A - ENSG00000070808 [100%]
CAMK2D - ENSG00000145349 [100%]
CAMK2G - ENSG00000148660 [96%]
 CAMK2A - ENSG00000070808 [100%]
CAMK2D - ENSG00000145349 [100%]
CAMK2G - ENSG00000148660 [97%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

     

Description

Immunohistochemical staining of human lateral ventricle shows strong cytoplasmic positivity in neurons.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human hippocampus shows moderate positivity in subsets of neuronal cells.
More information
 Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:250 1:275 1:10 1:175 1:300 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data for all of the genes Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Western Blot

Image

     

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

72.7, 60.4, 33.3, 19.6 72.7, 65.2, 62.2, 60.4, 60.0, 59.8, 59.6, 59.2, 59.0, 58.5, 58.0, 57.9, 57.8, 57.6, 56.4, 56.3, 56.0, 55.7, 55.4, 55.3, 55.2, 54.1, 51.0, 50.9, 41.1, 20.5, 19.6 72.7, 65.2, 62.2, 60.4, 60.0, 59.8, 59.6, 59.2, 59.0, 58.5, 58.0, 57.9, 57.8, 57.6, 56.4, 56.3, 56.0, 55.7, 55.4, 55.3, 55.2, 54.1, 51.0, 50.9, 41.1, 36.9, 33.3, 22.1 72.7, 65.2, 62.2, 60.4, 60.0, 59.8, 59.6, 59.2, 59.0, 58.5, 58.0, 57.9, 57.8, 57.6, 56.4, 56.3, 56.0, 55.7, 55.4, 55.3, 55.2, 54.1, 51.0, 41.1, 20.5, 19.6, 19.0, 12.8, 10.6 72.7, 60.4, 58.0, 57.9, 56.4, 55.2, 54.1, 51.0, 41.1, 33.3, 20.5, 20.4, 19.6, 19.0, 12.8 

Antibody dilution

1:250 1:250 1:110 1:150 1:500 

Validation WB

Uncertain: No bands detected Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

     

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:2000 1:900 1:1200  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
CAMK2B-001
 
CAMK2B-002
 
CAMK2B-003
 
CAMK2B-004
 
CAMK2B-005
 
CAMK2B-006
 
CAMK2B-007
 
CAMK2B-008
 
CAMK2B-009
 
CAMK2B-015
 
CAMK2B-016
 
CAMK2B-020
 
CAMK2B-021
 
CAMK2B-026
 
CAMK2B-027
 
CAMK2B-201
 
CAMK2B-202
 
 »