CASP8

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001302

 

Antibody HPA005688

 

Antibody HPA006191

 

Antibody CAB002047

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA001302 HPA005688 HPA006191 NCL-CASP-8 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 4 12 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

146 147 125  

Antigen sequence

GIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIP
VETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTW
YIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQP
 
LGEGKLDILKRVCAQINKSLLKIINDYEEFSKGEELCGVMTISDSPREQD
SESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLD
AGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICC
 
MEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKGALTTTFEELHF
EIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQ
EAPIYELTSQFTGLKCPSLAGKPKV
 
 

Matching transcripts

CASP8-002 - ENSP00000351273 [100%]
CASP8-006 - ENSP00000264275 [100%]
CASP8-009 - ENSP00000376091 [100%]
CASP8-012 - ENSP00000325722 [100%]
CASP8-014 - ENSP00000412523 [100%]
CASP8-017 - ENSP00000394434 [100%]
CASP8-201 - ENSP00000264274 [100%]
 CASP8-006 - ENSP00000264275 [100%]
CASP8-009 - ENSP00000376091 [100%]
CASP8-012 - ENSP00000325722 [100%]
CASP8-002 - ENSP00000351273 [91%]
CASP8-014 - ENSP00000412523 [91%]
 CASP8-017 - ENSP00000394434 [100%]
CASP8-201 - ENSP00000264274 [100%]
  

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
  Immunohistochemical staining of human duodenum shows strong positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6  HIER pH6 

Antibody dilution

1:450 1:65  1:60 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
  

Antibody dilution

1:143 1:87 1:38  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 229, 107, 78, 46, 31, 26, 16.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

61.8, 57.7, 55.4, 53.8, 45.9, 29.5 61.8, 57.7, 55.4, 53.8 45.9, 29.5 61.8, 57.7, 55.4, 53.8, 45.9, 29.5, 27.5, 25.9, 24.7, 23.5, 17.3, 14.9, 13.9, 9.4, 6.2 

Antibody dilution

1:250 1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:2000 1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CASP8-002
 
CASP8-006
 
CASP8-009
 
CASP8-012
 
CASP8-014
 
CASP8-017
 
CASP8-201