TNPO3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039555

 

Antibody HPA041537

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039555 HPA041537 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

119 110 

Antigen sequence

VRCVGKGSAALLQPLVTQMVNVYHVHQHSCFLYLGSILVDEYGMEEGCRQ
GLLDMLQALCIPTFQLLEQQNGLQNHPDTVDDLFRLATRFIQRSPVTLLR
SQVVIPILQWAIASTTLDH
 
RSLDSFLLSPEAAVGLLKGTALVLARLPLDKITECLSELCSVQVMALKKL
LSQEPSNGISSDPTVFLDRLAVIFRHTNPIVENGQTHPCQKVIQEIWPVL
SETLNKHRAD
 

Matching transcripts

TNPO3-001 - ENSP00000265388 [100%]
TNPO3-002 - ENSP00000420089 [100%]
TNPO3-003 - ENSP00000418646 [100%]
TNPO3-005 - ENSP00000418267 [100%]
TNPO3-201 - ENSP00000376936 [100%]
 TNPO3-001 - ENSP00000265388 [100%]
TNPO3-002 - ENSP00000420089 [100%]
TNPO3-005 - ENSP00000418267 [100%]
TNPO3-201 - ENSP00000376936 [100%]
TNPO3-003 - ENSP00000418646 [84%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine pancreas.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:15  

Literature conformity

Partly consistent with extensive gene/protein characterization data  

RNA consistency

Not done  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in vesicles.
More information
 

Antibody dilution

1:9 1:64 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

108.0, 104.2, 97.4, 96.7 108.0, 104.2, 97.4, 96.7 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
TNPO3-001
 
TNPO3-002
 
TNPO3-003
 
TNPO3-005
 
TNPO3-201