SMARCD1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004101

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA004101 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

86 

Antigen sequence

MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRP
GLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKK
 

Matching transcripts

SMARCD1-001 - ENSP00000378414 [100%]
SMARCD1-002 - ENSP00000370924 [100%]
SMARCD1-010 - ENSP00000448030 [100%]
SMARCD1-011 - ENSP00000447386 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:50 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli & vesicles.
More information
 

Antibody dilution

1:91 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

58.2, 53.3, 32.1, 30.3 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SMARCD1-001
 
SMARCD1-002
 
SMARCD1-010
 
SMARCD1-011