FGFR2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035305

 

Antibody HPA056562

 

Antibody CAB010886

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA035305 HPA056562 F0300 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

7 13 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

85 33  

Antigen sequence

PPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVL
IGEYLQIKGATPRDSGLYACTASRTVDSETWYFMV
 
DEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKR
 
 

Matching transcripts

FGFR2-001 - ENSP00000351276 [100%]
FGFR2-005 - ENSP00000358056 [100%]
FGFR2-006 - ENSP00000358052 [100%]
FGFR2-009 - ENSP00000263451 [100%]
FGFR2-010 - ENSP00000410294 [100%]
FGFR2-011 - ENSP00000358054 [100%]
FGFR2-016 - ENSP00000352309 [100%]
FGFR2-201 - ENSP00000309878 [100%]
FGFR2-203 - ENSP00000358057 [100%]
 FGFR2-001 - ENSP00000351276 [100%]
FGFR2-003 - ENSP00000337665 [100%]
FGFR2-004 - ENSP00000353262 [100%]
FGFR2-005 - ENSP00000358056 [100%]
FGFR2-006 - ENSP00000358052 [100%]
FGFR2-009 - ENSP00000263451 [100%]
FGFR2-010 - ENSP00000410294 [100%]
FGFR2-011 - ENSP00000358054 [100%]
FGFR2-016 - ENSP00000352309 [100%]
FGFR2-201 - ENSP00000309878 [100%]
FGFR2-202 - ENSP00000350166 [100%]
FGFR2-203 - ENSP00000358057 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in parietal cells.
More information
 Application not done for this antibody. Immunohistochemical staining of human epididymis shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:50  1:100 

Literature conformity

Partly consistent with extensive gene/protein characterization data  Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done  Not done 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

92.1, 92.0, 91.8, 88.2, 86.2, 86.1, 79.8, 79.2, 28.3 92.1, 92.0, 91.8, 88.2, 86.2, 86.1, 79.8, 79.3, 79.2, 76.4, 75.2, 28.3 92.1, 92.0, 91.8, 88.2, 86.2, 86.1, 79.8, 79.5, 79.3, 79.2, 76.4, 75.2, 66.7, 41.9, 28.3, 28.0 

Antibody dilution

1:250 1:80 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus, vesicles & cell junctions.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
 Application not done for this antibody. 

Antibody dilution

1:71 1:6  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Supportive: The subcellular location is supported by literature.  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
FGFR2-001
 
FGFR2-003
 
FGFR2-004
 
FGFR2-005
 
FGFR2-006
 
FGFR2-009
 
FGFR2-010
 
FGFR2-011
 
FGFR2-016
 
FGFR2-201
 
FGFR2-202
 
FGFR2-203
 
 »