TGFBR3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA008257

 

Antibody CAB018971

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA008257 2703.00.02 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

3 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Genetic immunization 

Length (aa)

130  

Antigen sequence

GYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSI
VIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNCS
LQQVRNPSSFQEQPHGNITFNMELYNTDLF
 
 

Matching transcripts

TGFBR3-001 - ENSP00000359426 [100%]
TGFBR3-002 - ENSP00000432638 [100%]
TGFBR3-006 - ENSP00000436127 [100%]
TGFBR3-201 - ENSP00000212355 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells and weak staining in cells of seminiferus ducts.
More information
 Immunohistochemical staining of human kidney shows distinct membranous positivity in cells in glomeruli.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:500 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

93.5, 93.4 93.5, 93.4, 9.3, 5.3, 3.5 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 

Antibody dilution

 1:125 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
TGFBR3-001
 
TGFBR3-002
 
TGFBR3-006
 
TGFBR3-201