NEDD4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039883

 

Antibody CAB001991

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Upstate
 

Product name

HPA039883 07-049 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

8 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

97  

Antigen sequence

TVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLHSDSEYI
KLMHRTSACLPSSQNVDCQININGELERPHSQMNKNHGILRRSISLG
 
 

Matching transcripts

NEDD4-001 - ENSP00000345530 [99%]
NEDD4-002 - ENSP00000424827 [99%]
NEDD4-003 - ENSP00000422705 [99%]
NEDD4-005 - ENSP00000426051 [99%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows distinct cytoplasmic positivity in subsets of neuronal cells.
More information
 Immunohistochemical staining of human pancreas shows cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:450 1:200 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

149.1, 147.4, 140.7, 43.1 149.1, 147.4, 140.7, 104.7, 104.2, 43.1, 4.3, 4.1 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoskeleton (intermediate filaments).
More information
  

Antibody dilution

1:200  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:6000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
NEDD4-001
 
NEDD4-002
 
NEDD4-003
 
NEDD4-005