SLC12A3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA028748

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA028748 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

145 

Antigen sequence

LLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEV
HILPDINQNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISD
EEITKNRVKSLRQVRLNEIVLDYSRDAALIVITLPIGRKGKCPSS
 

Matching transcripts

SLC12A3-001 - ENSP00000402152 [100%]
SLC12A3-002 - ENSP00000457552 [100%]
SLC12A3-003 - ENSP00000262502 [100%]
SLC12A3-005 - ENSP00000456149 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:350 

Literature conformity

Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNA expression data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

113.9, 113.8, 113.1, 113.0 

Antibody dilution

1:250 

Validation WB

Current setup is not applicable due to low RNA count 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SLC12A3-001
 
SLC12A3-002
 
SLC12A3-003
 
SLC12A3-005