SLC12A3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA028748

 

Antibody CAB022505

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Chemicon
 

Product name

HPA028748 AB3553 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

6 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

145  

Antigen sequence

LLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEV
HILPDINQNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISD
EEITKNRVKSLRQVRLNEIVLDYSRDAALIVITLPIGRKGKCPSS
 
 

Matching transcripts

SLC12A3-001 - ENSP00000402152 [100%]
SLC12A3-002 - ENSP00000457552 [100%]
SLC12A3-003 - ENSP00000262502 [100%]
SLC12A3-005 - ENSP00000456149 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human small intestine shows strong membranous and cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:350 1:100 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

113.9, 113.8, 113.1, 113.0 113.9, 113.8, 113.1, 113.0 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SLC12A3-001
 
SLC12A3-002
 
SLC12A3-003
 
SLC12A3-005