MAP3K13

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA016497

 

Antibody HPA036691

 

Antibody HPA036692

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA016497 HPA036691 HPA036692 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 7 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

136 94 86 

Antigen sequence

KKYPGTYKRHPVRPIIHPNAMEKLMKRKGVPHKSGMQTKRPDLLRSEGIP
TTEVAPTASPLSGSPKMSTSSSKSRYRSKPRHRRGNSRGSHSDFAAILKN
QPAQENSPHPTYLHQAQSQYPSLHHHNSLQQQYQQP
 
LADKLEDRLAEKLDDLLSQTPEIPIDISSHSDGLSDKECAVRRVKTQMSL
GKLCVEERGYENPMQFEESDCDSSDGECSDATVRTNKHYSSATW
 
MHGQDIATCANNLRYFGPAAALRSPLSNHAQRQLPGSSPDLISTAMAADC
WRSSEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSL
 

Matching transcripts

MAP3K13-001 - ENSP00000265026 [100%]
MAP3K13-003 - ENSP00000399910 [100%]
MAP3K13-004 - ENSP00000411483 [100%]
MAP3K13-006 - ENSP00000409325 [100%]
MAP3K13-201 - ENSP00000439257 [100%]
 MAP3K13-001 - ENSP00000265026 [100%]
MAP3K13-003 - ENSP00000399910 [100%]
MAP3K13-004 - ENSP00000411483 [100%]
MAP3K13-006 - ENSP00000409325 [100%]
MAP3K13-201 - ENSP00000439257 [100%]
 MAP3K13-001 - ENSP00000265026 [100%]
MAP3K13-003 - ENSP00000399910 [100%]
MAP3K13-004 - ENSP00000411483 [100%]
MAP3K13-006 - ENSP00000409325 [100%]
MAP3K13-201 - ENSP00000439257 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human pancreas shows moderate positivity in a subset of cells in exocrine cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in subsets of renal tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:25 1:100 1:10 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

108.3, 92.7, 85.4 108.3, 92.7, 85.4 108.3, 92.7, 85.4 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
MAP3K13-001
 
MAP3K13-003
 
MAP3K13-004
 
MAP3K13-006
 
MAP3K13-201