SNCB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035876

 

Antibody CAB002681

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Lab Vision/NeoMarkers
 

Product name

HPA035876 RB-9046 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

7 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

60  

Antigen sequence

GNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQ
EEYQEYEPEA
 
 

Matching transcripts

SNCB-001 - ENSP00000308057 [100%]
SNCB-002 - ENSP00000377296 [100%]
SNCB-003 - ENSP00000422223 [100%]
SNCB-005 - ENSP00000424073 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells, cells in the molecular layer and cells in the granular layer.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nuclear positivity in cells in molecular layer, cells in granular layer
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:500 1:1000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & golgi apparatus.
More information
 Immunofluorescent staining of human cell line U-251 MG shows no positivity.
More information
 

Antibody dilution

1:81 1:200 

Validation IF

Supportive: The subcellular location is supported by literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401075)
More information
  

Target mass (kDa)

14.3 14.3 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SNCB-001
 
SNCB-002
 
SNCB-003
 
SNCB-005