CELSR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA052976

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA052976 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

88 

Antigen sequence

PTSFRLQILNNYLQFEVSHGPSDVESVMLSGLRVTDGEWHHLLIELKNVK
EDSEMKHLVTMTLDYGMDQNKADIGGMLPGLTVRSVVV
 

Matching transcripts

CELSR1-001 - ENSP00000262738 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-549 shows positivity in plasma membrane.
More information
 

Antibody dilution

1:21 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Target too small/large to be analyzed with the present setup 

Target mass (kDa)

329.5 

Antibody dilution

 

Validation WB

 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:850 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CELSR1-001