BCORL1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031775

 

Antibody HPA031777

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA031775 HPA031777 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

79 84 

Antigen sequence

TSCLGSTSSPFVIFPEIVRNGDPSTWVKNSTALISTIPGTYVGVANPVPA
SLLLNKDPNLGLNRDPRHLPKQEPISIID
 
TSSDRIRMCGINEERRAPLSDEESTTGDCQHFGSQEFCVSSSFSKVELTA
VGSGSNARGADPDGSATEKLGHKSEDKPDDPQPK
 

Matching transcripts

BCORL1-001 - ENSP00000218147 [100%]
BCORL1-003 - ENSP00000399483 [100%]
BCORL1-004 - ENSP00000416520 [100%]
BCORL1-201 - ENSP00000307541 [100%]
BCORL1-202 - ENSP00000352253 [100%]
BCORL1-203 - ENSP00000437775 [100%]
 BCORL1-001 - ENSP00000218147 [100%]
BCORL1-201 - ENSP00000307541 [100%]
BCORL1-202 - ENSP00000352253 [100%]
BCORL1-203 - ENSP00000437775 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows strong luminal membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:500 1:30 

Literature conformity

Not consistent with gene/protein characterization data Not consistent with gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:179 1:7 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

190.6, 182.5, 167.0, 150.6, 79.3 190.6, 182.5, 167.0 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
BCORL1-001
 
BCORL1-003
 
BCORL1-004
 
BCORL1-201
 
BCORL1-202
 
BCORL1-203