FOLH1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA010593

 

Antibody CAB001451

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA010593 NCL-L-PSMA 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

3 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

106  

Antigen sequence

ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRR
GIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGP
GFTGNF
 
 

Matching transcripts

FOLH1-001 - ENSP00000256999 [100%]
FOLH1-002 - ENSP00000349129 [100%]
FOLH1-003 - ENSP00000344131 [100%]
FOLH1-004 - ENSP00000431463 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human prostate shows distinct cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:50 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

84.3, 82.5, 80.6, 78.8 84.3, 82.5, 80.6, 78.8, 50.1, 8.4, 7.5, 5.2, 5.1 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
FOLH1-001
 
FOLH1-002
 
FOLH1-003
 
FOLH1-004