MRPL28

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030594

 

Antibody HPA055589

 

Antibody CAB033542

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA030594 HPA055589 sc-55685 

Host species

Rabbit Rabbit Goat 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

6 13 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

74 89  

Antigen sequence

RRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVA
ELIQQLQQQALSEPAVVQKRASGQ
 
PVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKN
GQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANND
 
 

Matching transcripts

MRPL28-006 - ENSP00000199706 [100%]
MRPL28-008 - ENSP00000374326 [100%]
 MRPL28-006 - ENSP00000199706 [100%]
MRPL28-008 - ENSP00000374326 [100%]
MRPL28-009 - ENSP00000390399 [100%]
MRPL28-010 - ENSP00000398684 [100%]
MRPL28-011 - ENSP00000395305 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:300 1:700 1:15 

Literature conformity

Consistent with gene/protein characterization data Consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Consistent with RNAseq data Mainly consistent with RNAseq data Consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm, mitochondria & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:57 1:192  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

30.2 30.2, 28.5, 25.9, 23.1 30.2, 28.5, 25.9, 23.1, 5.0 

Antibody dilution

1:250 1:960 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:7650  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MRPL28-006
 
MRPL28-008
 
MRPL28-009
 
MRPL28-010
 
MRPL28-011