ADD1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035873

 

Antibody HPA035874

 

Antibody CAB009794

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA035873 HPA035874 sc-25731 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

13 13 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

57 85  

Antigen sequence

PPSTPIKLEEDLVPEPTTGDDSDAATFKPTLPDLSPDEPSEALGFPMLEK
EEEAHRP
 
SQVLCGVVMDRSLVQGELVTASKAIIEKEYQPHVIVSTTGPNPFTTLTDR
ELEEYRREVERKQKGSEENLDEAREQKEKSPPDQP
 
 

Matching transcripts

ADD1-001 - ENSP00000381197 [100%]
ADD1-015 - ENSP00000424143 [100%]
ADD1-201 - ENSP00000264758 [100%]
ADD1-203 - ENSP00000399828 [100%]
 ADD1-001 - ENSP00000381197 [100%]
ADD1-003 - ENSP00000381191 [100%]
ADD1-013 - ENSP00000423024 [100%]
ADD1-014 - ENSP00000421907 [100%]
ADD1-015 - ENSP00000424143 [100%]
ADD1-201 - ENSP00000264758 [100%]
ADD1-202 - ENSP00000381193 [100%]
ADD1-203 - ENSP00000399828 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in tubular cells.
More information
 Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:4000 1:3000 1:2000 

Literature conformity

Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly not consistent with RNAseq data Mainly consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line Hep G2 shows positivity in plasma membrane & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line Hep G2 shows positivity in plasma membrane.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane.
More information
 

Antibody dilution

1:200 1:120 1:2000 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

  Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

84.3, 81.0, 48.4 84.3, 81.0, 73.4, 73.3, 70.1, 48.4 84.3, 81.0, 73.4, 73.3, 70.1, 48.4, 15.9, 15.3, 12.8, 12.1, 8.1 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ADD1-001
 
ADD1-003
 
ADD1-013
 
ADD1-014
 
ADD1-015
 
ADD1-201
 
ADD1-202
 
ADD1-203