GNAS

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA018122

 

Antibody HPA027478

 

Antibody HPA028386

 

Antibody CAB010337

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA018122 HPA027478 HPA028386 sc-823 

Host species

Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

5 6 6 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

106 78 87  

Antigen sequence

SETDFETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRS
PDASPSRAPPSTQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCK
PKKPTR
 
GDESDDGTSGCLRWFQHRRNRRRRKPQRNLLRNFLVQAFGGCFGRSESPQ
PKASRSLKVKKVPLAEKRRQMRKEALEK
 
SGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVE
NDGEACGPPEVSRPNFQVLNPAFREAGAHGSYSPPPE
 
 

Matching transcripts

GNAS-002 - ENSP00000323571 [100%]
GNAS-014 - ENSP00000360115 [100%]
GNAS-022 - ENSP00000392000 [100%]
GNAS-025 - ENSP00000360139 [100%]
GNAS-023 - ENSP00000416234 [88%]
 GNAS-001 - ENSP00000360141 [100%]
GNAS-009 - ENSP00000360143 [100%]
GNAS-058 - ENSP00000360140 [100%]
 GNAS-001 - ENSP00000360141 [100%]
GNAS-009 - ENSP00000360143 [100%]
GNAS-058 - ENSP00000360140 [100%]
  

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells.
More information
 Immunohistochemical staining of human colon shows distinct positivity in microvilli of glandular cells.
More information
 Immunohistochemical staining of human fallopian tube shows distinct positivity in cilia.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:2500 1:35 1:10 1:300 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
More information
  Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane, cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:200 1:20  1:75 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available.  Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402577)
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

28.0, 19.0, 12.7 111.0, 109.6, 74.3 111.0, 109.6, 74.3 111.0, 109.6, 74.3, 67.8, 45.8, 45.7, 44.3, 44.2, 28.0, 22.7, 21.9, 20.8, 19.2, 19.0, 18.7, 18.3, 13.6, 13.3, 12.7, 10.4, 9.6, 9.4, 9.0, 8.0, 7.0, 3.9, 3.0 

Antibody dilution

1:250 1:250 1:250 1:500 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:20000 1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
GNAS-001
 
GNAS-002
 
GNAS-009
 
GNAS-014
 
GNAS-022
 
GNAS-023
 
GNAS-025
 
GNAS-058