ARHGAP4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001012

 

Antibody HPA001083

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA001012 HPA001083 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

114 115 

Antigen sequence

EHNGMRGLIPHKYITLPAGTEKQVVGAGLQTAGESGSSPEGLLASELVHR
PEPCTSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKT
SVRQGLGPASTTSP
 
DRQTIETEEVNKTLKATLQALLEVVASDDGDVLDSFQTSPSTESLKSTSS
DPGSRQAGRRRGQQQETETFYLTKLQEYLSGRSILAKLQAKHEKLQEALQ
RGDKEEQEVSWTQYT
 

Matching transcripts

ARHGAP4-001 - ENSP00000359045 [100%]
ARHGAP4-003 - ENSP00000203786 [100%]
ARHGAP4-011 - ENSP00000359033 [100%]
ARHGAP4-024 - ENSP00000377322 [100%]
ARHGAP4-201 - ENSP00000444169 [100%]
 ARHGAP4-001 - ENSP00000359045 [100%]
ARHGAP4-002 - ENSP00000397533 [100%]
ARHGAP4-003 - ENSP00000203786 [100%]
ARHGAP4-011 - ENSP00000359033 [100%]
ARHGAP4-024 - ENSP00000377322 [100%]
ARHGAP4-201 - ENSP00000444169 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.
More information
 Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp and cells in white pulp.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:350 1:250 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

109.4, 105.0, 102.6, 102.3, 85.4 109.4, 105.0, 102.6, 102.3, 85.4, 71.0 

Antibody dilution

1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm, focal adhesion sites & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:10 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
ARHGAP4-001
 
ARHGAP4-002
 
ARHGAP4-003
 
ARHGAP4-011
 
ARHGAP4-024
 
ARHGAP4-201