ESR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000449

 

Antibody HPA000450

 

Antibody CAB000037

 

Antibody CAB055099

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 DakoCytomation
 

Product name

HPA000449 HPA000450 NCL-L-ER-6F11 M7047 

Host species

Rabbit Rabbit Mouse Mouse 

Clonality

pAb pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known Supernatant 

Released in version

1 1 2 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known Native protein 

Length (aa)

142 146   

Antigen sequence

FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSG
YTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVC
NDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID
 
LQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHL
MAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDL
LLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYIT
 
 
 

Matching transcripts

ESR1-001 - ENSP00000206249 [100%]
ESR1-002 - ENSP00000342630 [100%]
ESR1-201 - ENSP00000405330 [100%]
ESR1-202 - ENSP00000387500 [100%]
ESR1-203 - ENSP00000415934 [100%]
 ESR1-001 - ENSP00000206249 [100%]
ESR1-002 - ENSP00000342630 [100%]
ESR1-009 - ENSP00000384064 [100%]
ESR1-201 - ENSP00000405330 [100%]
ESR1-202 - ENSP00000387500 [100%]
ESR1-203 - ENSP00000415934 [100%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human uterus shows strong nuclear positivity in both stroma and glandular cells.
More information
 Immunohistochemical staining of human corpus, uterine shows strong nuclear positivity in glandular cells and stromal cells.
More information
 Immunohistochemical staining of human corpus, uterine shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human uterus, pre-menopause shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH9 HIER pH6 

Antibody dilution

1:200 1:100 1:150 1:150 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNAseq data Mainly consistent with RNAseq data Mainly consistent with RNAseq data Consistent with RNAseq data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400046)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400046)
More information
 Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

66.2, 53.7 66.2, 53.7, 36.7 66.2, 53.7, 36.7, 35.3, 12.3, 12.1, 9.0 66.2, 53.7, 36.7, 35.3, 12.3, 12.1, 9.0 

Antibody dilution

1:250 1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:1000 1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
ESR1-001
 
ESR1-002
 
ESR1-009
 
ESR1-201
 
ESR1-202
 
ESR1-203