BLNK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA038309

 

Antibody HPA038310

 

Antibody CAB009333

 

Antibody CAB016291

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Santa Cruz Biotechnology
 

Product name

HPA038309 HPA038310 sc-15345 sc-8003 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

10 10 3 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein Not known 

Length (aa)

85 88   

Antigen sequence

EGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEH
SDSEMYVMPAEENADDSYEPPPVEQETRPVHPALP
 
HSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEAD
YVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSS
 
 
 

Matching transcripts

BLNK-001 - ENSP00000224337 [100%]
BLNK-002 - ENSP00000360218 [100%]
BLNK-004 - ENSP00000466331 [100%]
BLNK-201 - ENSP00000397487 [100%]
BLNK-202 - ENSP00000391924 [100%]
 BLNK-001 - ENSP00000224337 [100%]
BLNK-201 - ENSP00000397487 [100%]
BLNK-202 - ENSP00000391924 [100%]
BLNK-002 - ENSP00000360218 [85%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells and strong in non germinal center cells.
More information
 Immunohistochemical staining of human spleen shows moderate cytoplasmic and nuclear positivity in cells in white pulp.
More information
 Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
More information
 Immunohistochemical staining of human lymph node shows cytoplasmic positivity in subset of lymphoid cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:400 1:1200 1:75 1:50 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done Not done 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402244)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

50.5, 48.2, 46.5, 44.5, 13.8 50.5, 48.2, 46.5, 44.5 50.5, 48.2, 46.5, 44.5, 13.8, 7.4 50.5, 48.2, 46.5, 44.5, 13.8, 7.4 

Antibody dilution

1:250 1:250 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000 1:6000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
BLNK-001
 
BLNK-002
 
BLNK-004
 
BLNK-201
 
BLNK-202