CDC34

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002382

 

Antibody CAB005109

 

Antibody CAB047311

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 NCI-CPTC
 

Product name

HPA002382 sc-5616 CPTC-CDC34-2 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

4 3 9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein Recombinant protein 

Length (aa)

103   

Antigen sequence

LNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDG
VKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDD
SGT
 
 
 

Matching transcripts

CDC34-001 - ENSP00000215574 [100%]
CDC34-007 - ENSP00000475282 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
More information
 Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:50 1:200 1:325 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli & cytoplasm.
More information
   

Antibody dilution

1:67   

Validation IF

Supportive: The subcellular location is supported by literature.   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

26.7, 15.2 26.7, 15.8, 15.2, 13.8, 11.7, 11.5, 8.0, 0.8 26.7, 15.8, 15.2, 13.8, 11.7, 11.5, 8.0, 0.8 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:500   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
CDC34-001
 
CDC34-007