SNAP29

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031823

 

Antibody HPA056492

 

Antibody CAB037092

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA031823 HPA056492 S2069 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

6 13 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

63 74  

Antigen sequence

TDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILD
RLTTKVDKLDVNI
 
VASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFK
SKPVETPPEQNGTLTSQPNNRLKE
 
 

Matching transcripts

SNAP29-001 - ENSP00000215730 [100%]
SNAP29-003 - ENSP00000411095 [100%]
 SNAP29-001 - ENSP00000215730 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 Application not done for this antibody. Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:55  1:6000 

Literature conformity

Consistent with gene/protein characterization data  Consistent with gene/protein characterization data 

RNA consistency

Not done  Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Application not done for this antibody. 

Antibody dilution

1:30 1:79  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401502)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

29.0, 18.0 29.0 29.0, 18.0 

Antibody dilution

1:250 1:260 1:500 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:3150  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SNAP29-001
 
SNAP29-003