LGALS1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000646

 

Antibody HPA000687

 

Antibody HPA001130

 

Antibody CAB002157

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA000646 HPA000687 HPA001130 NCL-GAL1 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

1 13 13 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

110 116 110  

Antigen sequence

EVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTE
QREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMA
ADGDFKIKCV
 
LKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC
NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPN
RLNLEAINYMAADGDF
 
EVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTE
QREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMA
ADGDFKIKCV
 
 

Matching transcripts

LGALS1-001 - ENSP00000215909 [100%]
 LGALS1-001 - ENSP00000215909 [100%]
 LGALS1-001 - ENSP00000215909 [100%]
  

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human skin shows distinct nuclear positivity in melanocytes.
More information
 Application not done for this antibody. Application not done for this antibody. Immunohistochemical staining of human skin shows strong cytoplasmic positivity in melanocytes.
More information
 

Retrieval method

HIER pH6   HIER pH6 

Antibody dilution

1:400   1:100 

Literature conformity

Consistent with extensive gene/protein characterization data   Consistent with extensive gene/protein characterization data 

RNA consistency

Not done   Not done 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

14.7 14.7 14.7 14.7, 7.1, 4.0 

Antibody dilution

1:500 1:500 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:2000 1:500 1:2000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunofluorescence

Image

    

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
 Application not done for this antibody. 

Antibody dilution

 1:50 1:25  

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available.  
 

ANTIGEN VIEW

? »
 
 
 
LGALS1-001