HIF1A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001275

 

Antibody CAB017442

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Enzo Life Sciences
 

Product name

HPA001275 ADI-OSA-602 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

142  

Antigen sequence

KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQA
VGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACR
LLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALD
 
 

Matching transcripts

HIF1A-001 - ENSP00000338018 [100%]
HIF1A-003 - ENSP00000378446 [100%]
HIF1A-004 - ENSP00000451696 [100%]
HIF1A-201 - ENSP00000437955 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction center.
More information
 Immunohistochemical staining of human stomach shows cytoplasmic and nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:350 1:150 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus & nucleoli.
More information
  

Antibody dilution

1:40  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

95.6, 92.8, 92.7, 86.1 95.6, 92.8, 92.7, 86.1, 82.7 

Antibody dilution

1:500 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:1000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
HIF1A-001
 
HIF1A-003
 
HIF1A-004
 
HIF1A-201